Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KLRC2 protein

This Human KLRC2 protein spans the amino acid sequence from region 94-231aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NKG2-C type II integral membrane protein protein, NKG2-C-activating NK receptor protein, CD159 antigen-like family member C protein, KLRC 2 protein, NKG2C protein, KLRC2 protein

UniProt

P26717

Expression Region

94-231aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Extracellular of His-SUMO-tag and expression region is 94-231aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPFLEQNNSSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHL28 Recombinant Protein (Rat)
RP207350 100 µg

KLHL28 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Survivin, CT (FITC)
MBS6501694-01 0.1 mL

Survivin, CT (FITC)

Sign In for Pricing
View Details
Survivin, CT (FITC)
MBS6501694-02 5x 0.1 mL

Survivin, CT (FITC)

Sign In for Pricing
View Details
HSPB6, ID (HSPB6, Heat shock protein beta-6, Heat shock 20kD-like protein p20) (AP)
MBS6308705-01 0.2 mL

HSPB6, ID (HSPB6, Heat shock protein beta-6, Heat shock 20kD-like protein p20) (AP)

Sign In for Pricing
View Details
HSPB6, ID (HSPB6, Heat shock protein beta-6, Heat shock 20kD-like protein p20) (AP)
MBS6308705-02 5x 0.2 mL

HSPB6, ID (HSPB6, Heat shock protein beta-6, Heat shock 20kD-like protein p20) (AP)

Sign In for Pricing
View Details
LOC686126 3'UTR GFP Stable Cell Line
TU261389 1.0 mL

LOC686126 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details