Human KLRC2 protein
This Human KLRC2 protein spans the amino acid sequence from region 94-231aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
NKG2-C type II integral membrane protein protein, NKG2-C-activating NK receptor protein, CD159 antigen-like family member C protein, KLRC 2 protein, NKG2C protein, KLRC2 protein
UniProt
P26717
Expression Region
94-231aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
31.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full length of Extracellular of His-SUMO-tag and expression region is 94-231aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
IPFLEQNNSSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2138098-01 0.1 mL
APC Linked Monoclonal Antibody to Rh Blood Group, D Antigen (RHD)
Sign In for Pricing
View Details MBS2138098-02 0.2 mL
APC Linked Monoclonal Antibody to Rh Blood Group, D Antigen (RHD)
Sign In for Pricing
View Details MBS2138098-03 0.5 mL
APC Linked Monoclonal Antibody to Rh Blood Group, D Antigen (RHD)
Sign In for Pricing
View Details MBS2138098-04 1 mL
APC Linked Monoclonal Antibody to Rh Blood Group, D Antigen (RHD)
Sign In for Pricing
View Details MBS2138098-05 5 mL
APC Linked Monoclonal Antibody to Rh Blood Group, D Antigen (RHD)
Sign In for Pricing
View Details