Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCNJL protein

This Human CCNJL protein spans the amino acid sequence from region 315-435aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CCNJL

UniProt

Q8IV13

Expression Region

315-435aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVPGTPPTPTQVLFQPPAYPALGQPATTLAQFQTPVQDLCLAYRDSLQAHRSGSLLSGSTGSSLHTPYQPLQPLDMCPVPVPASLSMHMAIAAEPRHCLATTYGSSYFSGSHMFPTGCFDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1QTNF4 antibody - middle region
MBS3210786-01 0.1 mL

C1QTNF4 antibody - middle region

Sign In for Pricing
View Details
C1QTNF4 antibody - middle region
MBS3210786-02 5x 0.1 mL

C1QTNF4 antibody - middle region

Sign In for Pricing
View Details
Histone H3, phosphorylated (Ser10) (H3 Histone, Family 3A) (APC) discontinued
H5110-14M1-APC 100 µL

Histone H3, phosphorylated (Ser10) (H3 Histone, Family 3A) (APC) discontinued

Sign In for Pricing
View Details
C1orf175 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0215706 1.0 µg DNA

C1orf175 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Human V-Set and Ig Domain-Containing Protein 8/VSIG8 (C-Fc)
orb1648918-01 10 µg

Recombinant Human V-Set and Ig Domain-Containing Protein 8/VSIG8 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human V-Set and Ig Domain-Containing Protein 8/VSIG8 (C-Fc)
orb1648918-02 50 µg

Recombinant Human V-Set and Ig Domain-Containing Protein 8/VSIG8 (C-Fc)

Sign In for Pricing
View Details