Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCNJL protein

This Human CCNJL protein spans the amino acid sequence from region 315-435aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CCNJL

UniProt

Q8IV13

Expression Region

315-435aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVPGTPPTPTQVLFQPPAYPALGQPATTLAQFQTPVQDLCLAYRDSLQAHRSGSLLSGSTGSSLHTPYQPLQPLDMCPVPVPASLSMHMAIAAEPRHCLATTYGSSYFSGSHMFPTGCFDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti STAT6 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA)
IRBAMLSTAT6AP828120UL 1 Each

Rabbit Anti STAT6 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA)

Sign In for Pricing
View Details
Porcine Trypsin Antibody ELISA Kit
MBS037201-01 48 Well

Porcine Trypsin Antibody ELISA Kit

Sign In for Pricing
View Details
Porcine Trypsin Antibody ELISA Kit
MBS037201-02 96 Well

Porcine Trypsin Antibody ELISA Kit

Sign In for Pricing
View Details
Porcine Trypsin Antibody ELISA Kit
MBS037201-03 5x 96 Well

Porcine Trypsin Antibody ELISA Kit

Sign In for Pricing
View Details
Porcine Trypsin Antibody ELISA Kit
MBS037201-04 10x 96 Well

Porcine Trypsin Antibody ELISA Kit

Sign In for Pricing
View Details
Suz12 (Polycomb Protein Suz12, Suppressor of Zeste 12 Protein Homolog, Suz12, D11Ertd530e, Kiaa0160) (MaxLight 550)
MBS6459579-01 0.1 mL

Suz12 (Polycomb Protein Suz12, Suppressor of Zeste 12 Protein Homolog, Suz12, D11Ertd530e, Kiaa0160) (MaxLight 550)

Sign In for Pricing
View Details