Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CAST protein

This Human CAST protein spans the amino acid sequence from region 1-667aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CAST

UniProt

P20810

Expression Region

1-667aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

73.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPDYRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD170/SIGLEC5 Recombinant Protein
PPT-11234 100 µg

Human CD170/SIGLEC5 Recombinant Protein

Sign In for Pricing
View Details
Recombinant Haemophilus ducreyi UPF0756 membrane protein HD_1071 (HD_1071)
orb2920918-01 20 µg

Recombinant Haemophilus ducreyi UPF0756 membrane protein HD_1071 (HD_1071)

Sign In for Pricing
View Details
Recombinant Haemophilus ducreyi UPF0756 membrane protein HD_1071 (HD_1071)
orb2920918-02 100 µg

Recombinant Haemophilus ducreyi UPF0756 membrane protein HD_1071 (HD_1071)

Sign In for Pricing
View Details
APOLD1 (NM_001130415) Human Over-expression Lysate
LC427205 20 µg

APOLD1 (NM_001130415) Human Over-expression Lysate

Sign In for Pricing
View Details
FAM198B (GASK1B) (NM_016613) Human Tagged ORF Clone Lentiviral Particle
RC213306L3V 200 µL

FAM198B (GASK1B) (NM_016613) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant (E.coli) Zaire Ebola virus nucleoprotein (EBOV NP) (H.sapiens-wt/GIN/2014/Kissidougou-C15, 630-739aa , his-tag, >95%)
EVNP16-R-100 100 µg

Recombinant (E.coli) Zaire Ebola virus nucleoprotein (EBOV NP) (H.sapiens-wt/GIN/2014/Kissidougou-C15, 630-739aa , his-tag, >95%)

Sign In for Pricing
View Details