Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DSP protein

This Human DSP protein spans the amino acid sequence from region 78-300aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DSP

UniProt

P15924

Expression Region

78-300aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 78-300aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5BA1P 3'UTR Lenti-reporter-Luc Vector
35406081 1.0 µg

OR5BA1P 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
DUOXA1 (NM_144565) Human Tagged ORF Clone Lentiviral Particle
RC206754L3V 200 µL

DUOXA1 (NM_144565) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TNS1 Protein Lysate (Rat) with C-HA Tag
47268036 100 µg

TNS1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
DUSP28 (NM_001033575) Human Over-expression Lysate
LS285193-20ug 20 µg

DUSP28 (NM_001033575) Human Over-expression Lysate

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA, CD66e) discontinued
172168 100 µg

Carcinoembryonic Antigen (CEA, CD66e) discontinued

Sign In for Pricing
View Details
RANK Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-42227R-BF594 100 µL

RANK Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details