Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DSP protein

This Human DSP protein spans the amino acid sequence from region 78-300aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DSP

UniProt

P15924

Expression Region

78-300aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 78-300aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ddx49 (NM_001024922) Mouse Tagged ORF Clone
MR207702 10 µg

Ddx49 (NM_001024922) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
DDR2 Knockout HCT116 Polyclonal Cells
ARG7027 1 Million

DDR2 Knockout HCT116 Polyclonal Cells

Sign In for Pricing
View Details
CLDN15 Rabbit Polyclonal Antibody
orb574769 100 µL

CLDN15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ELISA kit for Human PDGF-B (Platelet Derived Growth Factor Subunit B)
E-EL-H1670 96 Tests

ELISA kit for Human PDGF-B (Platelet Derived Growth Factor Subunit B)

Sign In for Pricing
View Details
Lintuzumab Biosimilar - Research Grade
ICH5646-50mg 50 mg

Lintuzumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Human beta-GBS ELISA Kit
MBS3802027-01 48 Well

Human beta-GBS ELISA Kit

Sign In for Pricing
View Details