Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Asgr1 protein

This Mouse Asgr1 protein spans the amino acid sequence from region 61-284aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Asgr1

UniProt

P34927

Expression Region

61-284aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PQBP4 Protein Vector (Human) (pPM-C-HA)
PV112968 500 ng

PQBP4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Anti-HA-Tag Monoclonal Antibody
TBS10222-5 5 mg

Recombinant Anti-HA-Tag Monoclonal Antibody

Sign In for Pricing
View Details
Bauerenol acetate
HY-N2918 1 Each

Bauerenol acetate

Sign In for Pricing
View Details
Rifamycin Impurity 26
RM-R091626-01 10 mg

Rifamycin Impurity 26

Sign In for Pricing
View Details
Rifamycin Impurity 26
RM-R091626-02 100 mg

Rifamycin Impurity 26

Sign In for Pricing
View Details
Rifamycin Impurity 26
RM-R091626-03 25 mg

Rifamycin Impurity 26

Sign In for Pricing
View Details