Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Hras1 protein

This Rat Hras1 protein spans the amino acid sequence from region 2-186aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hras1 Hras

UniProt

P20171

Expression Region

2-186aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer, Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FKBP12 Antibody [PerCP]
NBP2-99149PCP 0.1 mL

Rabbit Polyclonal FKBP12 Antibody [PerCP]

Sign In for Pricing
View Details
G0S2 Lentiviral Activation Particles (m2)
sc-420440-LAC-2 200 µL

G0S2 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Tryptophan synthase beta chain (trpB)
MBS1305029-01 0.02 mg (E-Coli)

Recombinant Staphylococcus epidermidis Tryptophan synthase beta chain (trpB)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Tryptophan synthase beta chain (trpB)
MBS1305029-02 0.02 mg (Yeast)

Recombinant Staphylococcus epidermidis Tryptophan synthase beta chain (trpB)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Tryptophan synthase beta chain (trpB)
MBS1305029-03 0.1 mg (E-Coli)

Recombinant Staphylococcus epidermidis Tryptophan synthase beta chain (trpB)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Tryptophan synthase beta chain (trpB)
MBS1305029-04 0.1 mg (Yeast)

Recombinant Staphylococcus epidermidis Tryptophan synthase beta chain (trpB)

Sign In for Pricing
View Details