Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Hras1 protein

This Rat Hras1 protein spans the amino acid sequence from region 2-186aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hras1 Hras

UniProt

P20171

Expression Region

2-186aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer, Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX16 Goat Polyclonal Antibody
TA302615 100 µg

SNX16 Goat Polyclonal Antibody

Sign In for Pricing
View Details
SLC36A1 Peptide - N-terminal region
MBS3246466-01 0.1 mg

SLC36A1 Peptide - N-terminal region

Sign In for Pricing
View Details
SLC36A1 Peptide - N-terminal region
MBS3246466-02 5x 0.1 mg

SLC36A1 Peptide - N-terminal region

Sign In for Pricing
View Details
RINT1 sgRNA CRISPR Lentivector set (Human)
K1825401 3x 1.0 µg

RINT1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Human IgE/IGHE Protein, N-His
E55P6373 50 µg

Recombinant Human IgE/IGHE Protein, N-His

Sign In for Pricing
View Details
Β-crystallin S (CRYGS) Mouse ELISA Kit
B8472 96 Tests

Β-crystallin S (CRYGS) Mouse ELISA Kit

Sign In for Pricing
View Details