Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Doublecortin protein

This Doublecortin protein spans the amino acid sequence from region 1-361aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DBCN protein, Dbct protein, DC protein, DCX protein, DCX_HUMAN protein, Doublecortex protein, Doublin protein

UniProt

Q98SS5

Expression Region

1-361aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Gallus gallus (Chicken)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MELDFGHFDERDKASRNMRGTRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSANQKAPQSLASSNSAQAKENKDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDESECRVMKGSPAAATGSKSSPTPQKSSAKSPAPMRRSKSPADSANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKVDLYLPLSLDDSDSLGDSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin M3 (CNNM3) (NM_199078) Human Over-expression Lysate
LS026505 100 µg

Cyclin M3 (CNNM3) (NM_199078) Human Over-expression Lysate

Sign In for Pricing
View Details
VPS4B Polyclonal Antibody
E-AB-91273-01 60 µL

VPS4B Polyclonal Antibody

Sign In for Pricing
View Details
VPS4B Polyclonal Antibody
E-AB-91273-02 120 µL

VPS4B Polyclonal Antibody

Sign In for Pricing
View Details
VPS4B Polyclonal Antibody
E-AB-91273-03 200 µL

VPS4B Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Uricase Polyclonal Antibody
TMAB-01937-01 50 μL

Anti-Uricase Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Uricase Polyclonal Antibody
TMAB-01937-02 100 µL

Anti-Uricase Polyclonal Antibody

Sign In for Pricing
View Details