Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TXNDC12 protein

This Human TXNDC12 protein spans the amino acid sequence from region 27-172aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TXNDC12

UniProt

O95881

Expression Region

27-172aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 27-172aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCR V γ 3 (536) FITC
sc-53027 FITC 200 µg/mL

TCR V γ 3 (536) FITC

Sign In for Pricing
View Details
Multiplex Assay Kit for Fibroblast Growth Factor 21 (FGF21), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0029626 96 Tests

Multiplex Assay Kit for Fibroblast Growth Factor 21 (FGF21), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
TSC1, Phosphorylated (S312) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (Biotin)
MBS6359003-01 0.2 mL

TSC1, Phosphorylated (S312) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (Biotin)

Sign In for Pricing
View Details
TSC1, Phosphorylated (S312) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (Biotin)
MBS6359003-02 5x 0.2 mL

TSC1, Phosphorylated (S312) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (Biotin)

Sign In for Pricing
View Details
FAM26E CRISPR Activation Plasmid (m2)
sc-430470-ACT-2 20 µg

FAM26E CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
CMTM6 cDNA Clone
MBS1275290-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

CMTM6 cDNA Clone

Sign In for Pricing
View Details