Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Otc protein

This Mouse Otc protein spans the amino acid sequence from region 33-354aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Otc

UniProt

P11725

Expression Region

33-354aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 33-354aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQVQLKGRDLLTLKNFTGEEIQYMLWLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPSFLTTQDIHLGVNESLTDTARVLSSMTDAVLARVYKQSDLDTLAKEASIPIVNGLSDLYHPIQILADYLTLQEHYGSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDPNIVKLAEQYAKENGTKLSMTNDPLEAARGGNVLITDTWISMGQEDEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPVLQKPKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isocrotonic acid
503-64-0 1 Each

Isocrotonic acid

Sign In for Pricing
View Details
Rat Gamma-aminobutyric acid receptor subunit alpha-3, GABRA3 ELISA Kit
MBS9327992-01 48 Well

Rat Gamma-aminobutyric acid receptor subunit alpha-3, GABRA3 ELISA Kit

Sign In for Pricing
View Details
Rat Gamma-aminobutyric acid receptor subunit alpha-3, GABRA3 ELISA Kit
MBS9327992-02 96 Well

Rat Gamma-aminobutyric acid receptor subunit alpha-3, GABRA3 ELISA Kit

Sign In for Pricing
View Details
Rat Gamma-aminobutyric acid receptor subunit alpha-3, GABRA3 ELISA Kit
MBS9327992-03 5x 96 Well

Rat Gamma-aminobutyric acid receptor subunit alpha-3, GABRA3 ELISA Kit

Sign In for Pricing
View Details
Rat Gamma-aminobutyric acid receptor subunit alpha-3, GABRA3 ELISA Kit
MBS9327992-04 10x 96 Well

Rat Gamma-aminobutyric acid receptor subunit alpha-3, GABRA3 ELISA Kit

Sign In for Pricing
View Details
Methyl (2e) -3-cyclopentylprop-2-enoate
LFA82341-01 0.5 g

Methyl (2e) -3-cyclopentylprop-2-enoate

Sign In for Pricing
View Details