Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RAVER2 protein

This Human RAVER2 protein spans the amino acid sequence from region 1-140aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RAVER2

UniProt

Q9HCJ3

Expression Region

1-140aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRKILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VILIP1 (VSNL1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7D11]
TA801985BM 100 µL

VILIP1 (VSNL1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7D11]

Sign In for Pricing
View Details
Mouse IL-13 ELISA Kit
BSKM1006 96 Tests

Mouse IL-13 ELISA Kit

Sign In for Pricing
View Details
AAT Polyclonal Antibody
BT-AP00074-01 20 µL

AAT Polyclonal Antibody

Sign In for Pricing
View Details
AAT Polyclonal Antibody
BT-AP00074-02 50 µL

AAT Polyclonal Antibody

Sign In for Pricing
View Details
AAT Polyclonal Antibody
BT-AP00074-03 100 µL

AAT Polyclonal Antibody

Sign In for Pricing
View Details
Ugt8a (NM_011674) Mouse Untagged Clone
MC218267 10 µg

Ugt8a (NM_011674) Mouse Untagged Clone

Sign In for Pricing
View Details