Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep IL10 protein

This Sheep IL10 protein spans the amino acid sequence from region 20-177aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL10

UniProt

Q29408

Expression Region

20-177aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Ovis aries (Sheep)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRDASTLSDSSCTHFPASLPHMLRDVRAAFGKVKTFFQMKDQLNSMLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEQVKRVFNMLQERGVYKAMSEFDIFINYIESYMTTKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPX Recombinant Protein
OPCD03977-50UG 50 µg

HPX Recombinant Protein

Sign In for Pricing
View Details
LOC441476 Protein Lysate (Human) with C-Ha Tag
27201031 100 µg

LOC441476 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
BAT4 Antibody (C-term)
MBS9204019-01 0.08 mL

BAT4 Antibody (C-term)

Sign In for Pricing
View Details
BAT4 Antibody (C-term)
MBS9204019-02 0.4 mL

BAT4 Antibody (C-term)

Sign In for Pricing
View Details
BAT4 Antibody (C-term)
MBS9204019-03 5x 0.4 mL

BAT4 Antibody (C-term)

Sign In for Pricing
View Details
Rat ACE2 Antibody Pair Set
E-KAB-0633 50 μL & 100 μg

Rat ACE2 Antibody Pair Set

Sign In for Pricing
View Details