Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep IL10 protein

This Sheep IL10 protein spans the amino acid sequence from region 20-177aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL10

UniProt

Q29408

Expression Region

20-177aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Ovis aries (Sheep)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRDASTLSDSSCTHFPASLPHMLRDVRAAFGKVKTFFQMKDQLNSMLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEQVKRVFNMLQERGVYKAMSEFDIFINYIESYMTTKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adam3a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7588008 1.0 µg DNA

Adam3a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Mouse Monoclonal HNF1 Antibody (HNF1A/2087) [Janelia Fluor 549]
NBP2-79911JF549 0.1 mL

Mouse Monoclonal HNF1 Antibody (HNF1A/2087) [Janelia Fluor 549]

Sign In for Pricing
View Details
RDH5 shRNA (m) Lentiviral Particles
sc-76381-V 200 µL

RDH5 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
pML-EnCMV-HNRNPK-3×FLAG-SV40-Neo Plasmid
PVT37445 2 µg

pML-EnCMV-HNRNPK-3×FLAG-SV40-Neo Plasmid

Sign In for Pricing
View Details
CAPZA2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0362306 1.0 µg DNA

CAPZA2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Anti-Human oxLDL Antibody (SAA0554)
HP434043-01 50 µg

Anti-Human oxLDL Antibody (SAA0554)

Sign In for Pricing
View Details