Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DPYSL2 protein

This Human DPYSL2 protein spans the amino acid sequence from region 1-572aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DPYSL2

UniProt

Q16555

Expression Region

1-572aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PPAR alpha/NR1C1 Antibody (OTI1E8) [Dylight 594]
NBP2-73567DL594 0.1 mL

Mouse Monoclonal PPAR alpha/NR1C1 Antibody (OTI1E8) [Dylight 594]

Sign In for Pricing
View Details
Camel Low Density Lipoprotein Receptor ELISA Kit
MBS073176-01 48 Well

Camel Low Density Lipoprotein Receptor ELISA Kit

Sign In for Pricing
View Details
Camel Low Density Lipoprotein Receptor ELISA Kit
MBS073176-02 96 Well

Camel Low Density Lipoprotein Receptor ELISA Kit

Sign In for Pricing
View Details
Camel Low Density Lipoprotein Receptor ELISA Kit
MBS073176-03 5x 96 Well

Camel Low Density Lipoprotein Receptor ELISA Kit

Sign In for Pricing
View Details
Camel Low Density Lipoprotein Receptor ELISA Kit
MBS073176-04 10x 96 Well

Camel Low Density Lipoprotein Receptor ELISA Kit

Sign In for Pricing
View Details
USP20 Adenovirus (Rat)
49298056 1.0 mL

USP20 Adenovirus (Rat)

Sign In for Pricing
View Details