Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast T7 Helix-destabilizing protein

This Yeast T7 Helix-destabilizing protein spans the amino acid sequence from region 1-232aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

2.5

UniProt

P03696

Expression Region

1-232aa

Tag

Tag-Free

Source

Yeast

Origin

Escherichia phage T7 (Bacteriophage T7)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Raf-B antibody
STJ95353 200 µl

Anti-Raf-B antibody

Sign In for Pricing
View Details
AHA-1 Polyclonal Antibody
JOT-AP00301-01 20 µL

AHA-1 Polyclonal Antibody

Sign In for Pricing
View Details
AHA-1 Polyclonal Antibody
JOT-AP00301-02 50 μL

AHA-1 Polyclonal Antibody

Sign In for Pricing
View Details
AHA-1 Polyclonal Antibody
JOT-AP00301-03 100 µL

AHA-1 Polyclonal Antibody

Sign In for Pricing
View Details
Fatty Acid Binding Protein 2, aa1-132, Recombinant, Human (FABP2, Intestinal Fatty Acid Binding Protein, mal1, MGC133132, FABPI, I-FABP 2)
F0019-86B 100 µg

Fatty Acid Binding Protein 2, aa1-132, Recombinant, Human (FABP2, Intestinal Fatty Acid Binding Protein, mal1, MGC133132, FABPI, I-FABP 2)

Sign In for Pricing
View Details
MZT1 Rabbit Polyclonal Antibody (APC)
orb1001984 100 µL

MZT1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details