Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast lptC protein

This Yeast lptC protein spans the amino acid sequence from region 1-191aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LptC

UniProt

P0ADW0

Expression Region

1-191aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNPEGALSYRLIAQHVEYYSDQAVSWFTQPVLTTFDKDKIPTWSVKADKAKLTNDRMLYLYGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKNAELIEKVRTSYEIQNKQTQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parvin gamma (PARVG) (NM_022141) Human Recombinant Protein
PROTQ9HBI0 20 µg

Parvin gamma (PARVG) (NM_022141) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Anti-C9orf41 antibody
SL15329R-01 50 µL

Rabbit Anti-C9orf41 antibody

Sign In for Pricing
View Details
Rabbit Anti-C9orf41 antibody
SL15329R-02 100 µL

Rabbit Anti-C9orf41 antibody

Sign In for Pricing
View Details
UGDH Antibody
OAGA02452-100UL 100 µL

UGDH Antibody

Sign In for Pricing
View Details
Human T2R38-Strep full length protein-synthetic nanodisc
MBS1883632-01 0.01 mg

Human T2R38-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human T2R38-Strep full length protein-synthetic nanodisc
MBS1883632-02 0.05 mg

Human T2R38-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details