Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli bla protein

This E. coli bla protein spans the amino acid sequence from region 29-291aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bla

UniProt

P28585

Expression Region

29-291aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N6- (6-Aminohexyl) -dATP-ATTO-465
orb63353 120 µL

N6- (6-Aminohexyl) -dATP-ATTO-465

Sign In for Pricing
View Details
Lentiviral human PIGF shRNA (UAS) - Lentiviral human PIGF shRNA (UAS, RFP) (100)
GTR15321171 1 Vial

Lentiviral human PIGF shRNA (UAS) - Lentiviral human PIGF shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
(S)-2-Amino-4-(naphthalen-2-yl)butanoic acid
MBS9022989-01 1 g

(S)-2-Amino-4-(naphthalen-2-yl)butanoic acid

Sign In for Pricing
View Details
(S)-2-Amino-4-(naphthalen-2-yl)butanoic acid
MBS9022989-02 5x 1 g

(S)-2-Amino-4-(naphthalen-2-yl)butanoic acid

Sign In for Pricing
View Details
SYTL3 Recombinant Protein (Rat)
RP232010 100 µg

SYTL3 Recombinant Protein (Rat)

Sign In for Pricing
View Details
OCLN Polyclonal Antibody
RA21388-01 50 µL

OCLN Polyclonal Antibody

Sign In for Pricing
View Details