Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TANK protein

This Human TANK protein spans the amino acid sequence from region 1-119aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TANK

UniProt

Q92844

Expression Region

1-119aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AAO Antibody, FITC conjugated
CSB-PA333022LC01DZK-01 50 µg

AAO Antibody, FITC conjugated

Sign In for Pricing
View Details
AAO Antibody, FITC conjugated
CSB-PA333022LC01DZK-02 100 µg

AAO Antibody, FITC conjugated

Sign In for Pricing
View Details
Alpha casein Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-8245R-BF488-TR 20 µL

Alpha casein Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Porcine Desmin (DES) ELISA Kit-Sandwich
EK12F639-01 48 Test

Porcine Desmin (DES) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Porcine Desmin (DES) ELISA Kit-Sandwich
EK12F639-02 96 Tests

Porcine Desmin (DES) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Sbf2 (NM_177324) Mouse Tagged ORF Clone
MG215324 10 µg

Sbf2 (NM_177324) Mouse Tagged ORF Clone

Sign In for Pricing
View Details