Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TANK protein

This Human TANK protein spans the amino acid sequence from region 1-119aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TANK

UniProt

Q92844

Expression Region

1-119aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C20orf24 siRNA (h)
sc-76408 10 µM

C20orf24 siRNA (h)

Sign In for Pricing
View Details
FAM214B Recombinant Protein (Human)
RP057867 100 µg

FAM214B Recombinant Protein (Human)

Sign In for Pricing
View Details
TBX3 Rabbit Polyclonal Antibody
TA343574 100 µL

TBX3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Met Rabbit Polyclonal Antibody
E12-647 100 µg -100 µL

Met Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NKIRAS1 Protein Vector (Mouse) (pPM-C-HA)
PV205632 500 ng

NKIRAS1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Vmn2r28 siRNA (m)
sc-155145 10 µM

Vmn2r28 siRNA (m)

Sign In for Pricing
View Details