Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Slc1a2 protein

This Mouse Slc1a2 protein spans the amino acid sequence from region 143-238aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Slc1a2

UniProt

P43006

Expression Region

143-238aa

Tag

N-terminal GST-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTTFY 3'UTR GFP Stable Cell Line
TU064950 1.0 mL

MTTFY 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
2-Propenoic Acid
OR1023707 1 Each

2-Propenoic Acid

Sign In for Pricing
View Details
VPS4A Rabbit Polyclonal Antibody
TA367364 100 µL

VPS4A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human DHX29 siRNA
abx914122-01 15 nmol

Human DHX29 siRNA

Sign In for Pricing
View Details
Human DHX29 siRNA
abx914122-02 30 nmol

Human DHX29 siRNA

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to 5'-Nucleotidase, Ecto (NT5E)
MBS2053163-01 0.1 mL

HRP-Linked Monoclonal Antibody to 5'-Nucleotidase, Ecto (NT5E)

Sign In for Pricing
View Details