Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Slc1a2 protein

This Mouse Slc1a2 protein spans the amino acid sequence from region 143-238aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Slc1a2

UniProt

P43006

Expression Region

143-238aa

Tag

N-terminal GST-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-[5- (Trifluoromethyl) -1,2,4-oxadiazol-3-yl]propan-1-amine hydrochloride
JBD31953-01 50 mg

3-[5- (Trifluoromethyl) -1,2,4-oxadiazol-3-yl]propan-1-amine hydrochloride

Sign In for Pricing
View Details
3-[5- (Trifluoromethyl) -1,2,4-oxadiazol-3-yl]propan-1-amine hydrochloride
JBD31953-02 0.5 g

3-[5- (Trifluoromethyl) -1,2,4-oxadiazol-3-yl]propan-1-amine hydrochloride

Sign In for Pricing
View Details
Human IL-17A Polyclonal Antibody - Biotinylated
KPB1478H 50 µg

Human IL-17A Polyclonal Antibody - Biotinylated

Sign In for Pricing
View Details
FLASK RB, 1 CN 55/44 & 1 ASN 24/29 I/C J
4381A40 1 Unit

FLASK RB, 1 CN 55/44 & 1 ASN 24/29 I/C J

Sign In for Pricing
View Details
TIE1 (Tyrosine Kinase with Immunoglobulin-like and EGF-like Domains 1, JTK14, TIE) (Biotin)
MBS6172187-01 0.1 mL

TIE1 (Tyrosine Kinase with Immunoglobulin-like and EGF-like Domains 1, JTK14, TIE) (Biotin)

Sign In for Pricing
View Details
TIE1 (Tyrosine Kinase with Immunoglobulin-like and EGF-like Domains 1, JTK14, TIE) (Biotin)
MBS6172187-02 5x 0.1 mL

TIE1 (Tyrosine Kinase with Immunoglobulin-like and EGF-like Domains 1, JTK14, TIE) (Biotin)

Sign In for Pricing
View Details