Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ROR1 protein

This Human ROR1 protein spans the amino acid sequence from region 30-391aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ROR1

UniProt

Q01973

Expression Region

30-391aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMSAP1L1 (CAMSAP2) (NM_001297708) Human Untagged Clone
SC338051 10 µg

CAMSAP1L1 (CAMSAP2) (NM_001297708) Human Untagged Clone

Sign In for Pricing
View Details
CXCL13 (C-X-C Motif Chemokine 13, Angie, B cell-attracting Chemokine 1, BCA-1, B Lymphocyte Chemoattractant, CXC Chemokine BLC, Small-inducible Cytokine B13, BCA1, BLC, SCYB13) (MaxLight 490)
125503-ML490 100 µL

CXCL13 (C-X-C Motif Chemokine 13, Angie, B cell-attracting Chemokine 1, BCA-1, B Lymphocyte Chemoattractant, CXC Chemokine BLC, Small-inducible Cytokine B13, BCA1, BLC, SCYB13) (MaxLight 490)

Sign In for Pricing
View Details
Tert-Butyl 3- (3- ((2,5-dioxopyrrolidin-1-yl) oxy) -3-oxopropoxy) propanoate
OR1067709-01 50 mg

Tert-Butyl 3- (3- ((2,5-dioxopyrrolidin-1-yl) oxy) -3-oxopropoxy) propanoate

Sign In for Pricing
View Details
Tert-Butyl 3- (3- ((2,5-dioxopyrrolidin-1-yl) oxy) -3-oxopropoxy) propanoate
OR1067709-02 100 mg

Tert-Butyl 3- (3- ((2,5-dioxopyrrolidin-1-yl) oxy) -3-oxopropoxy) propanoate

Sign In for Pricing
View Details
Tert-Butyl 3- (3- ((2,5-dioxopyrrolidin-1-yl) oxy) -3-oxopropoxy) propanoate
OR1067709-03 250 mg

Tert-Butyl 3- (3- ((2,5-dioxopyrrolidin-1-yl) oxy) -3-oxopropoxy) propanoate

Sign In for Pricing
View Details
Tert-Butyl 3- (3- ((2,5-dioxopyrrolidin-1-yl) oxy) -3-oxopropoxy) propanoate
OR1067709-04 1 g

Tert-Butyl 3- (3- ((2,5-dioxopyrrolidin-1-yl) oxy) -3-oxopropoxy) propanoate

Sign In for Pricing
View Details