Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ROR1 protein

This Human ROR1 protein spans the amino acid sequence from region 30-391aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ROR1

UniProt

Q01973

Expression Region

30-391aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL1R2 Protein, His Tag
32-17878-100 100 µg

Recombinant Human IL1R2 Protein, His Tag

Sign In for Pricing
View Details
BCL2L12 AAV Vector (Mouse) (CMV)
13234104 1 µg

BCL2L12 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Nrgn sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
32168116 3x 1.0 µg

Nrgn sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
MAL2 Antibody - N-terminal region
ARP90021_P050-25UL 25 µL

MAL2 Antibody - N-terminal region

Sign In for Pricing
View Details
RAB10 Protein Lysate (Mouse) with C-HA Tag
38289034 100 µg

RAB10 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Recombinant Nostoc sp. Potassium-transporting ATPase B chain 1 (kdpB1)
orb2903385-01 20 µg

Recombinant Nostoc sp. Potassium-transporting ATPase B chain 1 (kdpB1)

Sign In for Pricing
View Details