Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ROR1 protein

This Human ROR1 protein spans the amino acid sequence from region 30-391aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ROR1

UniProt

Q01973

Expression Region

30-391aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Thyroid gland
CS536466 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Galectin 2 (GAL2) DIY ELISA Kit
MBS2162931-01 5x 96 Tests

Galectin 2 (GAL2) DIY ELISA Kit

Sign In for Pricing
View Details
Galectin 2 (GAL2) DIY ELISA Kit
MBS2162931-02 5x 96 Tests + MBS2089471 (Support Pack 1,5x 96 Tests)

Galectin 2 (GAL2) DIY ELISA Kit

Sign In for Pricing
View Details
Galectin 2 (GAL2) DIY ELISA Kit
MBS2162931-03 10x 96 Tests

Galectin 2 (GAL2) DIY ELISA Kit

Sign In for Pricing
View Details
Galectin 2 (GAL2) DIY ELISA Kit
MBS2162931-04 10x 96 Tests + MBS2089471 (Support Pack 1, 10x 96 Tests)

Galectin 2 (GAL2) DIY ELISA Kit

Sign In for Pricing
View Details
Olfr1254 Lentiviral Activation Particles (m2)
sc-434615-LAC-2 200 µL

Olfr1254 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details