Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Mybpc3 protein

This Rat Mybpc3 protein spans the amino acid sequence from region 645-864aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mybpc3

UniProt

P56741

Expression Region

645-864aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PKIHLDCPGSTPDTIVVVAGNKLRLDVPISGDPAPTVIWQKTITQGKKASAGPPPGAPEDAGADEEWVFDKKLLCETEGRVRVETTKDRSVFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCIVQWEPPAYDGGQPVLGYILERKKKKSYRWMRLNFDLLRELSHEARRMIEGVAYEMRVYAVNAVGMSRPSPASQPF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Arachidonate 15 lipoxygenase (ALOX15/LOG15) ELISA kit
GTR10435489 96 Well

Canine Arachidonate 15 lipoxygenase (ALOX15/LOG15) ELISA kit

Sign In for Pricing
View Details
RAB3A rabbit pAb
RA29169-01 50 µL

RAB3A rabbit pAb

Sign In for Pricing
View Details
RAB3A rabbit pAb
RA29169-02 100 µL

RAB3A rabbit pAb

Sign In for Pricing
View Details
Human PXDC1 qPCR Primer Pair
QH69109S 200 Tests

Human PXDC1 qPCR Primer Pair

Sign In for Pricing
View Details
GRB2 rabbit pAb
ES5630-01 50 µL

GRB2 rabbit pAb

Sign In for Pricing
View Details
GRB2 rabbit pAb
ES5630-02 100 µL

GRB2 rabbit pAb

Sign In for Pricing
View Details