Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Mybpc3 protein

This Rat Mybpc3 protein spans the amino acid sequence from region 645-864aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mybpc3

UniProt

P56741

Expression Region

645-864aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PKIHLDCPGSTPDTIVVVAGNKLRLDVPISGDPAPTVIWQKTITQGKKASAGPPPGAPEDAGADEEWVFDKKLLCETEGRVRVETTKDRSVFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCIVQWEPPAYDGGQPVLGYILERKKKKSYRWMRLNFDLLRELSHEARRMIEGVAYEMRVYAVNAVGMSRPSPASQPF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dbt Rat shRNA Plasmid (Locus ID 29611)
TL711751 1 Kit

Dbt Rat shRNA Plasmid (Locus ID 29611)

Sign In for Pricing
View Details
ZDHHC4 siRNA (m)
sc-155504 10 µM

ZDHHC4 siRNA (m)

Sign In for Pricing
View Details
Myosin heavy chain 2 Rabbit pAb
E47R10903 100 µL

Myosin heavy chain 2 Rabbit pAb

Sign In for Pricing
View Details
VPS13A CRISPRa sgRNA lentivector (set of three targets)(Human)
50168121 3x 1.0µg DNA

VPS13A CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
APG4B Rabbit Polyclonal Antibody (BF488)
orb2520693 100 µL

APG4B Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
CD68 Polyclonal Antibody, PerCP Conjugated
bs-1432R-PerCP-TR 20 µL

CD68 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details