Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Mybpc3 protein

This Rat Mybpc3 protein spans the amino acid sequence from region 645-864aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mybpc3

UniProt

P56741

Expression Region

645-864aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PKIHLDCPGSTPDTIVVVAGNKLRLDVPISGDPAPTVIWQKTITQGKKASAGPPPGAPEDAGADEEWVFDKKLLCETEGRVRVETTKDRSVFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCIVQWEPPAYDGGQPVLGYILERKKKKSYRWMRLNFDLLRELSHEARRMIEGVAYEMRVYAVNAVGMSRPSPASQPF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat masR (masR) ELISA Kit
YP-W200531-01 48 Tests

Rat masR (masR) ELISA Kit

Sign In for Pricing
View Details
Rat masR (masR) ELISA Kit
YP-W200531-02 96 Tests

Rat masR (masR) ELISA Kit

Sign In for Pricing
View Details
Recombinant Rhesus Macaque CXCR4 Protein, His (Fc)-Avi-tagged
CXCR4-940R 50 µg

Recombinant Rhesus Macaque CXCR4 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
STRIP1 Antibody
orb2684466-01 50 µL

STRIP1 Antibody

Sign In for Pricing
View Details
STRIP1 Antibody
orb2684466-02 100 µL

STRIP1 Antibody

Sign In for Pricing
View Details
STRIP1 Antibody
orb2684466-03 200 µL

STRIP1 Antibody

Sign In for Pricing
View Details