Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli rpsJ protein

This E.coli rpsJ protein spans the amino acid sequence from region 1-103aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RpsJ, nusE, b3321, JW3283

UniProt

P0A7R5

Expression Region

1-103aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASAH3 (ACER1) Rabbit Polyclonal Antibody
TA366949 100 µL

ASAH3 (ACER1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GJC1 Antibody, FITC conjugated
CSB-PA009458EC01HU-01 50 µg

GJC1 Antibody, FITC conjugated

Sign In for Pricing
View Details
GJC1 Antibody, FITC conjugated
CSB-PA009458EC01HU-02 100 µg

GJC1 Antibody, FITC conjugated

Sign In for Pricing
View Details
SPINK5 Adenovirus (Rat)
45335056 1.0 mL

SPINK5 Adenovirus (Rat)

Sign In for Pricing
View Details
DNAJC3 Protein Vector (Human) (pPM-C-HA)
18410021 500 ng

DNAJC3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
ATP2A2 Antibody, HRP conjugated
A13481-100UG 100 µg

ATP2A2 Antibody, HRP conjugated

Sign In for Pricing
View Details