Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli rpsJ protein

This E.coli rpsJ protein spans the amino acid sequence from region 1-103aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RpsJ, nusE, b3321, JW3283

UniProt

P0A7R5

Expression Region

1-103aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G-CSF (Murine) OmniKine™ ELISA Kit
OK-0173 1 Kit

G-CSF (Murine) OmniKine™ ELISA Kit

Sign In for Pricing
View Details
Human Calcyphosin, CAPS ELISA KIT
ELI-10746h 96 Tests

Human Calcyphosin, CAPS ELISA KIT

Sign In for Pricing
View Details
Pfkl sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4532308 1.0 µg DNA

Pfkl sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
CACNA1I Protein Vector (Mouse) (pPB-N-His)
PV160839 500 ng

CACNA1I Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
PAM Protein, Human, Recombinant (His Tag)
MBS8121479-01 0.05 mg

PAM Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
PAM Protein, Human, Recombinant (His Tag)
MBS8121479-02 5x 0.05 mg

PAM Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details