What is the catalog number for E.coli yedQ protein?

The catalog number for E.coli yedQ protein is orb245373.

What sizes are available for E.coli yedQ protein?

E.coli yedQ protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does E.coli yedQ protein come in?

E.coli yedQ protein is available in 3 different pack sizes.

Is E.coli yedQ protein in stock?

E.coli yedQ protein is currently made to order / not held in immediate stock. Contact us for lead time.

E.coli yedQ protein

This E.coli yedQ protein spans the amino acid sequence from region 381-564aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YedQ, b1956, JW5832

UniProt

P76330

Expression Region

381-564aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RRMVSNMYVLQSSLQWQAWHDTLTRLYNRGALFEKARPLAKLCQTHQHPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSLRAQDVAGRVGGEEFCVILPGASLTEAAEVAERIRLKLNEKEMLIAKSTTIRISASLGVSSSEETGDYDFEQLQSLADRRLYLAKQAGRNRVFASDNA