Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog IL8 protein

This Dog IL8 protein spans the amino acid sequence from region 23-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

310C protein, 9E3 protein, AMCF1 protein, CEF-4 protein, chemokine, CXC motif, ligand 8 protein, CXC chemokine ligand 8 protein, CXC chemokine ligand 8 protein, CXCL 8 protein, Emoctakin protein, GCP 1 protein, GCP-1 protein, GCP1 protein, Granulocyte chemotactic protein 1 protein, IL 8 protein, IL8/NAP1 form I protein, Inteleukin 8 protein, Interleukin8 protein, K60 protein, LECT protein, LECT protein, LYNAP protein, MDNCF protein, Monocyte derived neutrophil activating peptide protein, NAF protein, NAP 1 protein, Neutrophil activating factor protein, Neutrophil activating factor protein, Neutrophil activating peptide 1 protein, SCYB8 protein, T-cell chemotactic factor protein, TSG1 protein

UniProt

P41324

Expression Region

23-101aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Epigenetics, Immunology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Classic 18 boxes 32mm, 643x140x140mm, w/locking rod, B10
TE21360B10 1 Piece

Classic 18 boxes 32mm, 643x140x140mm, w/locking rod, B10

Sign In for Pricing
View Details
Cpped1 siRNA Oligos set (Rat)
16771176 3x 5 nmol

Cpped1 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Clvs2 Rat shRNA Lentiviral Particle (Locus ID 361459)
TL706995V 500 µL Each

Clvs2 Rat shRNA Lentiviral Particle (Locus ID 361459)

Sign In for Pricing
View Details
CSF2RA Polyclonal Antibody
MBS126505-01 0.02 mL

CSF2RA Polyclonal Antibody

Sign In for Pricing
View Details
CSF2RA Polyclonal Antibody
MBS126505-02 0.05 mL

CSF2RA Polyclonal Antibody

Sign In for Pricing
View Details
CSF2RA Polyclonal Antibody
MBS126505-03 0.1 mL

CSF2RA Polyclonal Antibody

Sign In for Pricing
View Details