Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Hpx protein

This Rat Hpx protein spans the amino acid sequence from region 24-460aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hpx

UniProt

P20059

Expression Region

24-460aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NPLPAAHETVAKGENGTKPDSDVIEHCSDAWSFDATTMDHNGTMLFFKGEFVWRGHSGIRELISERWKNPVTSVDAAFRGPDSVFLIKEDKVWVYPPEKKENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFATRTQKERSWPAVGNCTAALRWLERYYCFQGNKFLRFNPVTGEVPPRYPLDARDYFISCPGRGHGKLRNGTAHGNSTHPMHSRCNADPGLSALLSDHRGATYAFSGSHYWRLDSSRDGWHSWPIAHHWPQGPSAVDAAFSWDEKVYLIQGTQVYVFLTKGGNNLVSGYPKRLEKELGSPPGISLDTIDAAFSCPGSSKLYVTSGRRLWWLDLKSGAQATWAELSWPHEKVDGALCLEKSLGPYSCSSNGPNLFFIHGPNLYCYSSIDKLNAAKSLPQPQKVNSILGCSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kcnj2 Mouse Monoclonal Antibody [Clone ID: N112B/14]
75-210 100 µL

Kcnj2 Mouse Monoclonal Antibody [Clone ID: N112B/14]

Sign In for Pricing
View Details
SERPINB2 (Center) Rabbit Polyclonal Antibody
AP17618PU-N 400 µL

SERPINB2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Drying Oven BODR-102
BODR-102 1 Unit

Drying Oven BODR-102

Sign In for Pricing
View Details
Human HSH2D activation kit by CRISPRa
GA113786 1 Kit

Human HSH2D activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS700749 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
MAX Rabbit Polyclonal Antibody
TA378365 100 µL

MAX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details