Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Hpx protein

This Rat Hpx protein spans the amino acid sequence from region 24-460aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hpx

UniProt

P20059

Expression Region

24-460aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NPLPAAHETVAKGENGTKPDSDVIEHCSDAWSFDATTMDHNGTMLFFKGEFVWRGHSGIRELISERWKNPVTSVDAAFRGPDSVFLIKEDKVWVYPPEKKENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFATRTQKERSWPAVGNCTAALRWLERYYCFQGNKFLRFNPVTGEVPPRYPLDARDYFISCPGRGHGKLRNGTAHGNSTHPMHSRCNADPGLSALLSDHRGATYAFSGSHYWRLDSSRDGWHSWPIAHHWPQGPSAVDAAFSWDEKVYLIQGTQVYVFLTKGGNNLVSGYPKRLEKELGSPPGISLDTIDAAFSCPGSSKLYVTSGRRLWWLDLKSGAQATWAELSWPHEKVDGALCLEKSLGPYSCSSNGPNLFFIHGPNLYCYSSIDKLNAAKSLPQPQKVNSILGCSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIF1A, CT (HIF1A, BHLHE78, MOP1, PASD8, Hypoxia-inducible factor 1-alpha, ARNT-interacting protein, Basic-helix-loop-helix-PAS protein MOP1, Class E basic helix-loop-helix protein 78, Member of PAS protein 1, PAS domain-containing protein 8) (FITC)
MBS6306464-01 0.2 mL

HIF1A, CT (HIF1A, BHLHE78, MOP1, PASD8, Hypoxia-inducible factor 1-alpha, ARNT-interacting protein, Basic-helix-loop-helix-PAS protein MOP1, Class E basic helix-loop-helix protein 78, Member of PAS protein 1, PAS domain-containing protein 8) (FITC)

Sign In for Pricing
View Details
HIF1A, CT (HIF1A, BHLHE78, MOP1, PASD8, Hypoxia-inducible factor 1-alpha, ARNT-interacting protein, Basic-helix-loop-helix-PAS protein MOP1, Class E basic helix-loop-helix protein 78, Member of PAS protein 1, PAS domain-containing protein 8) (FITC)
MBS6306464-02 5x 0.2 mL

HIF1A, CT (HIF1A, BHLHE78, MOP1, PASD8, Hypoxia-inducible factor 1-alpha, ARNT-interacting protein, Basic-helix-loop-helix-PAS protein MOP1, Class E basic helix-loop-helix protein 78, Member of PAS protein 1, PAS domain-containing protein 8) (FITC)

Sign In for Pricing
View Details
DEFB125 Human Over-expression Lysate
orb1374040 20 µg

DEFB125 Human Over-expression Lysate

Sign In for Pricing
View Details
LOH12CR1 Antibody, FITC conjugated
MBS1494965-01 0.05 mg

LOH12CR1 Antibody, FITC conjugated

Sign In for Pricing
View Details
LOH12CR1 Antibody, FITC conjugated
MBS1494965-02 0.1 mg

LOH12CR1 Antibody, FITC conjugated

Sign In for Pricing
View Details
LOH12CR1 Antibody, FITC conjugated
MBS1494965-03 5x 0.1 mg

LOH12CR1 Antibody, FITC conjugated

Sign In for Pricing
View Details