Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fxn protein

This Mouse Fxn protein spans the amino acid sequence from region 78-207aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fxn

UniProt

O35943

Expression Region

78-207aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LEAP2-set siRNA/shRNA/RNAi Lentivector (Human)
26425091 4x 500 ng

LEAP2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Human ACPL2 (PXYLP1) (NM_152282) AAV Particle
RC207863A1V 250 µL

Human ACPL2 (PXYLP1) (NM_152282) AAV Particle

Sign In for Pricing
View Details
Olr324 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7315505 3x 1.0 µg

Olr324 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
SAFB2 (F8F1A) Rabbit Monoclonal Antibody
CST 27482T 20 µL

SAFB2 (F8F1A) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
OBFC2A Antibody Blocking peptide
orb1460520 500 µg

OBFC2A Antibody Blocking peptide

Sign In for Pricing
View Details
Polyclonal Antibody to Galectin 3 (GAL3)
TRV-0041188-01 20 µL

Polyclonal Antibody to Galectin 3 (GAL3)

Sign In for Pricing
View Details