Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fxn protein

This Mouse Fxn protein spans the amino acid sequence from region 78-207aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fxn

UniProt

O35943

Expression Region

78-207aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal USP11 Antibody
NBP1-80639-25ul 25 µL

Rabbit Polyclonal USP11 Antibody

Sign In for Pricing
View Details
Stacking platform large 12x12 w dimpled mat (3.0 separation)
MIX7116 1 Each

Stacking platform large 12x12 w dimpled mat (3.0 separation)

Sign In for Pricing
View Details
EGFR Polyclonal Antibody
BT-AP02873-01 20 µL

EGFR Polyclonal Antibody

Sign In for Pricing
View Details
EGFR Polyclonal Antibody
BT-AP02873-02 50 µL

EGFR Polyclonal Antibody

Sign In for Pricing
View Details
EGFR Polyclonal Antibody
BT-AP02873-03 100 µL

EGFR Polyclonal Antibody

Sign In for Pricing
View Details
ADRA1A Antibody
E19-4852 100 µg -100 µL

ADRA1A Antibody

Sign In for Pricing
View Details