Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fxn protein

This Mouse Fxn protein spans the amino acid sequence from region 78-207aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fxn

UniProt

O35943

Expression Region

78-207aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMPKgamma2 Antibody
ABF9006 100 µg

AMPKgamma2 Antibody

Sign In for Pricing
View Details
IGFBP3 Rabbit Polyclonal Antibody (Carrier-free)
orb3118416 100 µg

IGFBP3 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Human Arginyl tRNA synthetase (RARS) activation kit by CRISPRa
GA104027 1 Kit

Human Arginyl tRNA synthetase (RARS) activation kit by CRISPRa

Sign In for Pricing
View Details
PRPSAP2 HDR Plasmid (h)
sc-418509-HDR 20 µg

PRPSAP2 HDR Plasmid (h)

Sign In for Pricing
View Details
Purified Anti-Human CD56 Antibody[5.1H11]
E-AB-F1239A-01 25 µg

Purified Anti-Human CD56 Antibody[5.1H11]

Sign In for Pricing
View Details
Purified Anti-Human CD56 Antibody[5.1H11]
E-AB-F1239A-02 100 µg

Purified Anti-Human CD56 Antibody[5.1H11]

Sign In for Pricing
View Details