Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Dermcidin protein

This Human Dermcidin protein spans the amino acid sequence from region 20-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AIDD protein, DCD 1 protein, dcd protein, DCD-1 protein, DSEP protein, PIF protein, Preproteolysin protein

UniProt

P81605

Expression Region

20-110aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCT6B sgRNA CRISPR Lentivector (Human) (Target 3)
K0397404 1.0 µg DNA

CCT6B sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Repaglinide
S1426-10mM/1mL 10 mM/1mL

Repaglinide

Sign In for Pricing
View Details
ASCL2 (Achaete-Scute Complex Homolog 2 (Drosophila), Achaete-scute Homolog 2, ASH2, ASH-2, bHLHa45, BHLHA45, Class A Basic Helix-loop-helix Protein 45, hASH2, HASH2, Mash2, MASH2) (MaxLight 750)
MBS6247274-01 0.1 mL

ASCL2 (Achaete-Scute Complex Homolog 2 (Drosophila), Achaete-scute Homolog 2, ASH2, ASH-2, bHLHa45, BHLHA45, Class A Basic Helix-loop-helix Protein 45, hASH2, HASH2, Mash2, MASH2) (MaxLight 750)

Sign In for Pricing
View Details
ASCL2 (Achaete-Scute Complex Homolog 2 (Drosophila), Achaete-scute Homolog 2, ASH2, ASH-2, bHLHa45, BHLHA45, Class A Basic Helix-loop-helix Protein 45, hASH2, HASH2, Mash2, MASH2) (MaxLight 750)
MBS6247274-02 5x 0.1 mL

ASCL2 (Achaete-Scute Complex Homolog 2 (Drosophila), Achaete-scute Homolog 2, ASH2, ASH-2, bHLHa45, BHLHA45, Class A Basic Helix-loop-helix Protein 45, hASH2, HASH2, Mash2, MASH2) (MaxLight 750)

Sign In for Pricing
View Details
ACOT8 siRNA (Human)
CRH6733-01 15 nmol

ACOT8 siRNA (Human)

Sign In for Pricing
View Details
ACOT8 siRNA (Human)
CRH6733-02 30 nmol

ACOT8 siRNA (Human)

Sign In for Pricing
View Details