Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Dermcidin protein

This Human Dermcidin protein spans the amino acid sequence from region 20-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AIDD protein, DCD 1 protein, dcd protein, DCD-1 protein, DSEP protein, PIF protein, Preproteolysin protein

UniProt

P81605

Expression Region

20-110aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MICB Antibody Picoband® (PE Conjugate)
PB9613-PE 100 µg/Vial

Anti-MICB Antibody Picoband® (PE Conjugate)

Sign In for Pricing
View Details
TFEB (NM_007162) Human Tagged Lenti ORF Clone
RC207153L2 10 µg

TFEB (NM_007162) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LOC298139 Protein Vector (Rat) (pPM-C-HA)
27099026 500 ng

LOC298139 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
ZER1 Antibody
GWB-MV596B 50 µg

ZER1 Antibody

Sign In for Pricing
View Details
Human TARC Construction Kit w/Developing Reagents
RHF640CKC 960 Tests

Human TARC Construction Kit w/Developing Reagents

Sign In for Pricing
View Details
NMRAL1 Knockout MES-OV Polyclonal Cells
ARG6180 1 Million

NMRAL1 Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details