Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog Mast Cell Chymase protein

This Dog Mast Cell Chymase protein spans the amino acid sequence from region 22-249aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-chymase protein, Chymase 1 protein, Chymase 1 mast cell protein, chymase 1 preproprotein transcript E protein, chymase 1 preproprotein transcript I protein, Chymase protein, Chymase, heart protein, Chymase, mast cell protein, CMA1 protein, CYH protein, CYM protein, Mast cell chymase 1 protein, Mast cell protease 3 protein, Mast cell protease 5 protein, Mast cell protease I protein, Mast cell protease III protein, Mcp-5 protein, MCP3P protein, Mcpt5 protein

UniProt

P21842

Expression Region

22-249aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGTESKPHSRPYMAHLEILTLRNHLASCGGFLIRRNFVLTAAHCAGRFIMVTLGAHNIQKKEDTWQKLEVIKQFPHPKYDDLTLRHDIMLLKLKEKANLTLAVGTLPLSPQFNFVPPGRMCRVAGWGKRQVNGSGSDTLQEVKLRLMDPQACRHYMAFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGQNDAKPPAVFTRISHYRPWINKVLKQNKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Urgcp Mouse Gene Knockout Kit (CRISPR)
KN518749 1 Kit

Urgcp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TOX1 (TOX) (NM_014729) Human Recombinant Protein
TP303792 20 µg

TOX1 (TOX) (NM_014729) Human Recombinant Protein

Sign In for Pricing
View Details
EIF4EBP1 (NM_004095) Human Recombinant Protein
TP720177L 500 µg

EIF4EBP1 (NM_004095) Human Recombinant Protein

Sign In for Pricing
View Details
TREM1 Rabbit Polyclonal Antibody
TA361889 100 µL

TREM1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Delta-9,11-promestriene
TRC-D231673-2.5MG 2.5 mg

Delta-9,11-promestriene

Sign In for Pricing
View Details
Beta-Zeranol
TRC-Z346005-5MG 5 mg

Beta-Zeranol

Sign In for Pricing
View Details