Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NDUFV2 protein

This Human NDUFV2 protein spans the amino acid sequence from region 35-249aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NDUFV2

UniProt

P19404

Expression Region

35-249aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Growth Differentiation Factor 3 (GDF3), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0028996 96 Tests

Multiplex Assay Kit for Growth Differentiation Factor 3 (GDF3), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
InVivoMAb Anti-Human TNFa/TNF-alpha (Iv0050)
HF879010-01 50 µg

InVivoMAb Anti-Human TNFa/TNF-alpha (Iv0050)

Sign In for Pricing
View Details
InVivoMAb Anti-Human TNFa/TNF-alpha (Iv0050)
HF879010-02 100 µg

InVivoMAb Anti-Human TNFa/TNF-alpha (Iv0050)

Sign In for Pricing
View Details
InVivoMAb Anti-Human TNFa/TNF-alpha (Iv0050)
HF879010-03 1 mg

InVivoMAb Anti-Human TNFa/TNF-alpha (Iv0050)

Sign In for Pricing
View Details
ATM Antibody
orb688755-01 50 µg

ATM Antibody

Sign In for Pricing
View Details
ATM Antibody
orb688755-02 100 µg

ATM Antibody

Sign In for Pricing
View Details