Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SNX24 protein

This Human SNX24 protein spans the amino acid sequence from region 1-169aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SNX24

UniProt

Q9Y343

Expression Region

1-169aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-169aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAP1 Rabbit Polyclonal Antibody (BF680)
orb2401315 100 µL

DAP1 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Recombinant Clostridium Perfringens rpmG Protein (aa 1-49) (strain ATCC 13124 / NCTC 8237 / Type A)
VAng-Lsx00785-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Perfringens rpmG Protein (aa 1-49) (strain ATCC 13124 / NCTC 8237 / Type A)

Sign In for Pricing
View Details
Yap1 (NM_001034002) Rat Tagged Lenti ORF Clone
RR205630L3 10 µg

Yap1 (NM_001034002) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NCAPH2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV712666 1.0 µg DNA

NCAPH2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
ARF5 Antibody
E19-8451-2 100 µg -100 µL

ARF5 Antibody

Sign In for Pricing
View Details
SLC43A1 polyclonal antibody
orb645106-01 50 μL

SLC43A1 polyclonal antibody

Sign In for Pricing
View Details