Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SNX24 protein

This Human SNX24 protein spans the amino acid sequence from region 1-169aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SNX24

UniProt

Q9Y343

Expression Region

1-169aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-169aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED4 Rabbit Polyclonal Antibody (Fluoro647)
orb3101811 100 µg

MED4 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Recombinant Glucocorticoid Induced Tumor Necrosis Factor Receptor (GITR)
TRV-0014835-01 10 µg

Recombinant Glucocorticoid Induced Tumor Necrosis Factor Receptor (GITR)

Sign In for Pricing
View Details
Recombinant Glucocorticoid Induced Tumor Necrosis Factor Receptor (GITR)
TRV-0014835-02 50 µg

Recombinant Glucocorticoid Induced Tumor Necrosis Factor Receptor (GITR)

Sign In for Pricing
View Details
Recombinant Glucocorticoid Induced Tumor Necrosis Factor Receptor (GITR)
TRV-0014835-03 100 µg

Recombinant Glucocorticoid Induced Tumor Necrosis Factor Receptor (GITR)

Sign In for Pricing
View Details
Recombinant Glucocorticoid Induced Tumor Necrosis Factor Receptor (GITR)
TRV-0014835-04 200 µg

Recombinant Glucocorticoid Induced Tumor Necrosis Factor Receptor (GITR)

Sign In for Pricing
View Details
Recombinant Glucocorticoid Induced Tumor Necrosis Factor Receptor (GITR)
TRV-0014835-05 500 µg

Recombinant Glucocorticoid Induced Tumor Necrosis Factor Receptor (GITR)

Sign In for Pricing
View Details