Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DAXX protein

This Human DAXX protein spans the amino acid sequence from region 1-233aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DAXX, BING2, DAP6

UniProt

Q9UER7

Expression Region

1-233aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF kappa B (S276) (Nuclear factor of kappa light polypeptide gene enhancer in B Cells 3, Nuclear factor NF-kappa-B p65 subunit, Transcription factor p65, NFKB3, RELA) (Azide free) (HRP) discontinued
038922-HRP 200 µL

NF kappa B (S276) (Nuclear factor of kappa light polypeptide gene enhancer in B Cells 3, Nuclear factor NF-kappa-B p65 subunit, Transcription factor p65, NFKB3, RELA) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
2-{[3- (4-Chlorophenyl) -4-oxo-3,4-dihydroquinazolin-2-yl]sulfanyl}acetohydrazide
IFA76445-01 250 mg

2-{[3- (4-Chlorophenyl) -4-oxo-3,4-dihydroquinazolin-2-yl]sulfanyl}acetohydrazide

Sign In for Pricing
View Details
2-{[3- (4-Chlorophenyl) -4-oxo-3,4-dihydroquinazolin-2-yl]sulfanyl}acetohydrazide
IFA76445-02 2.5 g

2-{[3- (4-Chlorophenyl) -4-oxo-3,4-dihydroquinazolin-2-yl]sulfanyl}acetohydrazide

Sign In for Pricing
View Details
SLK (C-term) rabbit polyclonal antibody, Aff - Purified
AP32275PU-N 50 µL

SLK (C-term) rabbit polyclonal antibody, Aff - Purified

Sign In for Pricing
View Details
Sodium thioglycolate
sc-215887D 5 Kg

Sodium thioglycolate

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Canine IgM Fc fragment Secondary Antibody (Azide Free)
NBP2-69671 1 mL

Goat Polyclonal Goat anti-Canine IgM Fc fragment Secondary Antibody (Azide Free)

Sign In for Pricing
View Details