Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SRSF1 protein

This Human SRSF1 protein spans the amino acid sequence from region 2-248aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SRSF1

UniProt

Q07955

Expression Region

2-248aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-248aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Type Lectin Domain Family 7, Member A (CLEC7A) Magnetic Luminex Assay Kit
LKU605972 96 Tests

C-Type Lectin Domain Family 7, Member A (CLEC7A) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Human Microfibrillar Associated Protein 4 (MFAP4) ELISA Kit
orb777728-01 48 Tests

Human Microfibrillar Associated Protein 4 (MFAP4) ELISA Kit

Sign In for Pricing
View Details
Human Microfibrillar Associated Protein 4 (MFAP4) ELISA Kit
orb777728-02 96 Tests

Human Microfibrillar Associated Protein 4 (MFAP4) ELISA Kit

Sign In for Pricing
View Details
EZH1 Antibody (Center) [APR31969G]
APR31969G-01 50 µL

EZH1 Antibody (Center) [APR31969G]

Sign In for Pricing
View Details
EZH1 Antibody (Center) [APR31969G]
APR31969G-02 100 µL

EZH1 Antibody (Center) [APR31969G]

Sign In for Pricing
View Details
EZH1 Antibody (Center) [APR31969G]
APR31969G-03 200 µL

EZH1 Antibody (Center) [APR31969G]

Sign In for Pricing
View Details