Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DNMT3A protein

This Human DNMT3A protein spans the amino acid sequence from region 680-902aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DNMT3A

UniProt

Q9Y6K1

Expression Region

680-902aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Phospholipase A2 receptor 1, 180kDa (PLA2R1) ELISA Kit
orb1655027-01 48 Tests

Human Phospholipase A2 receptor 1, 180kDa (PLA2R1) ELISA Kit

Sign In for Pricing
View Details
Human Phospholipase A2 receptor 1, 180kDa (PLA2R1) ELISA Kit
orb1655027-02 96 Tests

Human Phospholipase A2 receptor 1, 180kDa (PLA2R1) ELISA Kit

Sign In for Pricing
View Details
NCTC 135 Media, Modified
MBS652786-01 25 L

NCTC 135 Media, Modified

Sign In for Pricing
View Details
NCTC 135 Media, Modified
MBS652786-02 50 L

NCTC 135 Media, Modified

Sign In for Pricing
View Details
NCTC 135 Media, Modified
MBS652786-03 100 L

NCTC 135 Media, Modified

Sign In for Pricing
View Details
NCTC 135 Media, Modified
MBS652786-04 250 L

NCTC 135 Media, Modified

Sign In for Pricing
View Details