Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MBNL1 protein

This Human MBNL1 protein spans the amino acid sequence from region 1-382aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MBNL1

UniProt

Q9NR56

Expression Region

1-382aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RWDD3 (NM_001278247) Human Untagged Clone
SC334274 10 µg

RWDD3 (NM_001278247) Human Untagged Clone

Sign In for Pricing
View Details
NR5A2 antibody
20R-A2453 50 ug

NR5A2 antibody

Sign In for Pricing
View Details
Bis[2- (di-i-propylphosphino) -4-methylphenyl]amine
OR1060113-01 100 mg

Bis[2- (di-i-propylphosphino) -4-methylphenyl]amine

Sign In for Pricing
View Details
Bis[2- (di-i-propylphosphino) -4-methylphenyl]amine
OR1060113-02 250 mg

Bis[2- (di-i-propylphosphino) -4-methylphenyl]amine

Sign In for Pricing
View Details
Bis[2- (di-i-propylphosphino) -4-methylphenyl]amine
OR1060113-03 1 g

Bis[2- (di-i-propylphosphino) -4-methylphenyl]amine

Sign In for Pricing
View Details
Human Transmembrane glycoprotein NMB ELISA Kit
MBS9428947-01 96 Tests

Human Transmembrane glycoprotein NMB ELISA Kit

Sign In for Pricing
View Details