Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MSRA protein

This Human MSRA protein spans the amino acid sequence from region 24-235aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MSRA

UniProt

Q9UJ68

Expression Region

24-235aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Serum response factor-binding protein 1 (SRFBP1) ELISA Kit
abx383452 96 Tests

Human Serum response factor-binding protein 1 (SRFBP1) ELISA Kit

Sign In for Pricing
View Details
Brentuximab Biosimilar - Research Grade
ICH5137-25mg 25 mg

Brentuximab Biosimilar - Research Grade

Sign In for Pricing
View Details
DLL1/Delta1, His, Human
Z05223-500 500 µg

DLL1/Delta1, His, Human

Sign In for Pricing
View Details
Porcine 5'-3' Exoribonuclease 2 (XRN2) ELISA Kit
MBS9918588-01 48 Well

Porcine 5'-3' Exoribonuclease 2 (XRN2) ELISA Kit

Sign In for Pricing
View Details
Porcine 5'-3' Exoribonuclease 2 (XRN2) ELISA Kit
MBS9918588-02 96 Well

Porcine 5'-3' Exoribonuclease 2 (XRN2) ELISA Kit

Sign In for Pricing
View Details
Porcine 5'-3' Exoribonuclease 2 (XRN2) ELISA Kit
MBS9918588-03 5x 96 Well

Porcine 5'-3' Exoribonuclease 2 (XRN2) ELISA Kit

Sign In for Pricing
View Details